PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_29AD9D378.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 83aa    MW: 9406.89 Da    PI: 8.8399
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_29AD9D378.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR121.67e-072965138
                   FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCske 38
                           +fYn Y+ e+GF vr +ks+ + + +   +++fvC + 
  Traes_3AL_29AD9D378.2 29 EFYNLYSWEMGFGVRYAKSRLNVHRK-KCMQEFVCACA 65
                           6*****************99995555.77899***875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MRAYAENKGG TVVNPSLGTS FDTVEEAYEF YNLYSWEMGF GVRYAKSRLN VHRKKCMQEF  60
VCACAVSMVL GNKMRLTLSI GHL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703064e-70HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233160.12e-31PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010231466.13e-31PREDICTED: uncharacterized protein LOC104582684 isoform X1
TrEMBLW5CBF42e-57W5CBF4_WHEAT; Uncharacterized protein
STRINGMLOC_43923.32e-32(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6191991
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18960.12e-08FAR1-related sequence 12
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]